Lineage for d1wfwa_ (1wfw A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946225Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 946439Protein Kalirin-9a [117147] (1 species)
  7. 946440Species Mouse (Mus musculus) [TaxId:10090] [117148] (1 PDB entry)
    Uniprot Q8BTT9 594-651
  8. 946441Domain d1wfwa_: 1wfw A: [114595]
    Structural genomics target

Details for d1wfwa_

PDB Entry: 1wfw (more details)

PDB Description: solution structure of sh3 domain of mouse kalirin-9a protein
PDB Compounds: (A:) Kalirin-9a

SCOPe Domain Sequences for d1wfwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgstmtvikdyyalkeneicvsqgevvqvlavnqqnmclvyqpasdhspaaegwv
pgsilapfsgpssg

SCOPe Domain Coordinates for d1wfwa_:

Click to download the PDB-style file with coordinates for d1wfwa_.
(The format of our PDB-style files is described here.)

Timeline for d1wfwa_: