Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Kalirin-9a [117147] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117148] (1 PDB entry) Uniprot Q8BTT9 594-651 |
Domain d1wfwa1: 1wfw A:8-68 [114595] Other proteins in same PDB: d1wfwa2, d1wfwa3 Structural genomics target |
PDB Entry: 1wfw (more details)
SCOPe Domain Sequences for d1wfwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wfwa1 b.34.2.1 (A:8-68) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} stmtvikdyyalkeneicvsqgevvqvlavnqqnmclvyqpasdhspaaegwvpgsilap f
Timeline for d1wfwa1: