Lineage for d1wfwa1 (1wfw A:8-68)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783139Protein Kalirin-9a [117147] (1 species)
  7. 2783140Species Mouse (Mus musculus) [TaxId:10090] [117148] (1 PDB entry)
    Uniprot Q8BTT9 594-651
  8. 2783141Domain d1wfwa1: 1wfw A:8-68 [114595]
    Other proteins in same PDB: d1wfwa2, d1wfwa3
    Structural genomics target

Details for d1wfwa1

PDB Entry: 1wfw (more details)

PDB Description: solution structure of sh3 domain of mouse kalirin-9a protein
PDB Compounds: (A:) Kalirin-9a

SCOPe Domain Sequences for d1wfwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfwa1 b.34.2.1 (A:8-68) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]}
stmtvikdyyalkeneicvsqgevvqvlavnqqnmclvyqpasdhspaaegwvpgsilap
f

SCOPe Domain Coordinates for d1wfwa1:

Click to download the PDB-style file with coordinates for d1wfwa1.
(The format of our PDB-style files is described here.)

Timeline for d1wfwa1: