PDB entry 1wfw

View 1wfw on RCSB PDB site
Description: Solution structure of SH3 domain of mouse Kalirin-9a protein
Class: signaling protein
Keywords: SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kalirin-9a
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2210407G14
    Database cross-references and differences (RAF-indexed):
    • GB BAB25925 (7-67)
      • cloning artifact (0-6)
      • engineered (28)
      • engineered (56)
      • cloning artifact (68-73)
    Domains in SCOPe 2.01: d1wfwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfwA (A:)
    gssgssgstmtvikdyyalkeneicvsqgevvqvlavnqqnmclvyqpasdhspaaegwv
    pgsilapfsgpssg