![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
![]() | Protein Cellulose synthase A catalytic subunit 7, IRX3 [118294] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118295] (1 PDB entry) Uniprot Q9SWW6 26-95 |
![]() | Domain d1weoa_: 1weo A: [114561] Structural genomics target complexed with zn |
PDB Entry: 1weo (more details)
SCOPe Domain Sequences for d1weoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gssgssgpkplknldgqfceicgdqigltvegdlfvacnecgfpacrpcyeyerregtqn cpqcktrykrlrgsprvegdedeedidsgpssg
Timeline for d1weoa_: