PDB entry 1weo

View 1weo on RCSB PDB site
Description: Solution structure of RING-finger in the catalytic subunit (IRX3) of cellulose synthase
Class: DNA binding protein
Keywords: NMR, structure genomics, RING-finger, cellulose synthase, catalytic subunit(IRX3), RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulose synthase, catalytic subunit (IRX3)
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RAFL09-35-F05
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SWW6 (7-86)
      • cloning artifact (0-6)
      • cloning artifact (87-92)
    Domains in SCOPe 2.04: d1weoa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1weoA (A:)
    gssgssgpkplknldgqfceicgdqigltvegdlfvacnecgfpacrpcyeyerregtqn
    cpqcktrykrlrgsprvegdedeedidsgpssg