Lineage for d1weoa_ (1weo A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1966943Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1966944Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1966945Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 1966961Protein Cellulose synthase A catalytic subunit 7, IRX3 [118294] (1 species)
  7. 1966962Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118295] (1 PDB entry)
    Uniprot Q9SWW6 26-95
  8. 1966963Domain d1weoa_: 1weo A: [114561]
    Structural genomics target
    complexed with zn

Details for d1weoa_

PDB Entry: 1weo (more details)

PDB Description: solution structure of ring-finger in the catalytic subunit (irx3) of cellulose synthase
PDB Compounds: (A:) cellulose synthase, catalytic subunit (IRX3)

SCOPe Domain Sequences for d1weoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gssgssgpkplknldgqfceicgdqigltvegdlfvacnecgfpacrpcyeyerregtqn
cpqcktrykrlrgsprvegdedeedidsgpssg

SCOPe Domain Coordinates for d1weoa_:

Click to download the PDB-style file with coordinates for d1weoa_.
(The format of our PDB-style files is described here.)

Timeline for d1weoa_: