Lineage for d1we8a_ (1we8 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202875Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1202876Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1202877Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 1202958Protein Tudor and KH domain containing protein, Tdrkh [117912] (1 species)
  7. 1202959Species Mouse (Mus musculus) [TaxId:10090] [117913] (1 PDB entry)
    Uniprot Q80VL1 118-208
  8. 1202960Domain d1we8a_: 1we8 A: [114548]
    Structural genomics target; 2nd KH domain

Details for d1we8a_

PDB Entry: 1we8 (more details)

PDB Description: solution structure of kh domain in protein bab28342
PDB Compounds: (A:) Tudor and KH domain containing protein

SCOPe Domain Sequences for d1we8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgiltentpvfeqlsvpqrsvgriigrggetirsickasgakitcdkesegtlll
srlikisgtqkevaaakhlilekvsedeelrkriahsasgpssg

SCOPe Domain Coordinates for d1we8a_:

Click to download the PDB-style file with coordinates for d1we8a_.
(The format of our PDB-style files is described here.)

Timeline for d1we8a_: