Lineage for d1we8a1 (1we8 A:8-98)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947165Protein Tudor and KH domain containing protein, Tdrkh [117912] (1 species)
  7. 2947166Species Mouse (Mus musculus) [TaxId:10090] [117913] (1 PDB entry)
    Uniprot Q80VL1 118-208
  8. 2947167Domain d1we8a1: 1we8 A:8-98 [114548]
    Other proteins in same PDB: d1we8a2, d1we8a3
    Structural genomics target; 2nd KH domain

Details for d1we8a1

PDB Entry: 1we8 (more details)

PDB Description: solution structure of kh domain in protein bab28342
PDB Compounds: (A:) Tudor and KH domain containing protein

SCOPe Domain Sequences for d1we8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we8a1 d.51.1.1 (A:8-98) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]}
iltentpvfeqlsvpqrsvgriigrggetirsickasgakitcdkesegtlllsrlikis
gtqkevaaakhlilekvsedeelrkriahsa

SCOPe Domain Coordinates for d1we8a1:

Click to download the PDB-style file with coordinates for d1we8a1.
(The format of our PDB-style files is described here.)

Timeline for d1we8a1: