Lineage for d1w73d_ (1w73 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841554Protein 2,4-dienoyl-CoA reductase, mitochondrial (DECR) [117421] (1 species)
  7. 2841555Species Human (Homo sapiens) [TaxId:9606] [117422] (3 PDB entries)
    Uniprot Q16698 35-328
  8. 2841563Domain d1w73d_: 1w73 D: [114310]
    complexed with gol, nap

Details for d1w73d_

PDB Entry: 1w73 (more details), 2.1 Å

PDB Description: binary structure of human decr solved by semet sad.
PDB Compounds: (D:) 2,4-dienoyl-CoA reductase

SCOPe Domain Sequences for d1w73d_:

Sequence, based on SEQRES records: (download)

>d1w73d_ c.2.1.2 (D:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens) [TaxId: 9606]}
mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtiee

Sequence, based on observed residues (ATOM records): (download)

>d1w73d_ c.2.1.2 (D:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens) [TaxId: 9606]}
mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
kagveamskslaaewgkygmrfnviqpgpiktkemigripcgrlgtveelanlaaflcsd
yaswingavikfdggeevlisgefndlrkvtkeqwdtiee

SCOPe Domain Coordinates for d1w73d_:

Click to download the PDB-style file with coordinates for d1w73d_.
(The format of our PDB-style files is described here.)

Timeline for d1w73d_: