![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins) follows the extended AAA-ATPase domain |
![]() | Protein CDC6-like protein APE0152, C-terminal domain [116788] (1 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [116789] (2 PDB entries) Uniprot Q9YFU8 |
![]() | Domain d1w5ta1: 1w5t A:300-409 [114255] Other proteins in same PDB: d1w5ta2, d1w5tb2, d1w5tc2 protein/DNA complex; complexed with adp, anp, mg |
PDB Entry: 1w5t (more details), 2.4 Å
SCOPe Domain Sequences for d1w5ta1:
Sequence, based on SEQRES records: (download)
>d1w5ta1 a.4.5.11 (A:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]} thelealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiyl khltslglvdakpsgrgmrgrttlfrlaphlpadrlievvdniiqakmas
>d1w5ta1 a.4.5.11 (A:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]} thelealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiyl khltslglvdakpsttlfrlaphlpadrlievvdniiqakmas
Timeline for d1w5ta1:
![]() Domains from other chains: (mouse over for more information) d1w5tb1, d1w5tb2, d1w5tc1, d1w5tc2 |