SCOPe 2.08: Domain d1w5fa1: 1w5f A:22-215

Lineage for d1w5fa1 (1w5f A:22-215)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Cell-division protein FtsZ [52492] (9 species)

7. Species Thermotoga maritima [TaxId:2336] [117498] (1 PDB entry)
   Uniprot O08398 22-335

8. Domain d1w5fa1: 1w5f A:22-215 [114247]
   Other proteins in same PDB: d1w5fa2, d1w5fb2
   complexed with g2p, mg

Details for d1w5fa1

PDB Entry: 1w5f, 2 Å

PDB Description: ftsz, t7 mutated, domain swapped (t. maritima)

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d1w5fa1:

Sequence; same for both SEQRES and ATOM records:

>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]}
lkikvigvggagnnainrmieigihgvefvavntdlqvleasnadvkiqigenitrglga
ggrpeigeqaaleseekirevlqdthmvfitagfgggtgtgaspviakiakemgiltvai
vttpfyfegperlkkaieglkklrkhvdtlikisnnklmeelprdvkikdaflkadetlh
qgvkgiselitkrg

Timeline for d1w5fa1:

• d1w5fa1 first appeared in SCOP 1.71
  
• d1w5fa1 appears in SCOPe 2.07