Lineage for d1w5fb1 (1w5f B:22-215)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863169Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2863259Species Thermotoga maritima [TaxId:2336] [117498] (1 PDB entry)
    Uniprot O08398 22-335
  8. 2863261Domain d1w5fb1: 1w5f B:22-215 [114249]
    Other proteins in same PDB: d1w5fa2, d1w5fb2
    complexed with g2p, mg

Details for d1w5fb1

PDB Entry: 1w5f (more details), 2 Å

PDB Description: ftsz, t7 mutated, domain swapped (t. maritima)
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d1w5fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5fb1 c.32.1.1 (B:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]}
lkikvigvggagnnainrmieigihgvefvavntdlqvleasnadvkiqigenitrglga
ggrpeigeqaaleseekirevlqdthmvfitagfgggtgtgaspviakiakemgiltvai
vttpfyfegperlkkaieglkklrkhvdtlikisnnklmeelprdvkikdaflkadetlh
qgvkgiselitkrg

SCOPe Domain Coordinates for d1w5fb1:

Click to download the PDB-style file with coordinates for d1w5fb1.
(The format of our PDB-style files is described here.)

Timeline for d1w5fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w5fb2