PDB entry 1w5f

View 1w5f on RCSB PDB site
Description: FtsZ, T7 mutated, domain swapped (T. maritima)
Class: cell division
Keywords: cell division, cell-division protein, GTP-binding, multigene family, septation, tubulin, ftsz, filament, z-ring, gtpase, domain swapped
Deposited on 2004-08-06, released 2004-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08398 (222-End)
      • engineered mutation (217)
      • engineered mutation (219)
      • engineered mutation (224)
    • PDB 1W5F (220-221)
    Domains in SCOPe 2.08: d1w5fa1, d1w5fa2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08398 (222-End)
      • engineered mutation (217)
      • engineered mutation (219)
      • engineered mutation (224)
    • PDB 1W5F (220-221)
    Domains in SCOPe 2.08: d1w5fb1, d1w5fb2
  • Heterogens: G2P, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w5fA (A:)
    mgfdldvekkkenrnipqannlkikvigvggagnnainrmieigihgvefvavntdlqvl
    easnadvkiqigenitrglgaggrpeigeqaaleseekirevlqdthmvfitagfgggtg
    tgaspviakiakemgiltvaivttpfyfegperlkkaieglkklrkhvdtlikisnnklm
    eelprdvkikdaflkadetlhqgvkgiselitkrgyirltsrfariesvmkdagaailgi
    gvgkgehrareaakkameskliehpvenassivfnitapsnirmeevheaamiirqnsse
    dadvkfglifddevpddeirvifiatrfpdedkilfpegdipaiyryglegll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5fA (A:)
    lkikvigvggagnnainrmieigihgvefvavntdlqvleasnadvkiqigenitrglga
    ggrpeigeqaaleseekirevlqdthmvfitagfgggtgtgaspviakiakemgiltvai
    vttpfyfegperlkkaieglkklrkhvdtlikisnnklmeelprdvkikdaflkadetlh
    qgvkgiselitkrgyirltsrfariesvmkdagaailgigvgkgehrareaakkameskl
    iehpvenassivfnitapsnirmeevheaamiirqnssedadvkfglifddevpddeirv
    ifiatrfpdedkilfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w5fB (B:)
    mgfdldvekkkenrnipqannlkikvigvggagnnainrmieigihgvefvavntdlqvl
    easnadvkiqigenitrglgaggrpeigeqaaleseekirevlqdthmvfitagfgggtg
    tgaspviakiakemgiltvaivttpfyfegperlkkaieglkklrkhvdtlikisnnklm
    eelprdvkikdaflkadetlhqgvkgiselitkrgyirltsrfariesvmkdagaailgi
    gvgkgehrareaakkameskliehpvenassivfnitapsnirmeevheaamiirqnsse
    dadvkfglifddevpddeirvifiatrfpdedkilfpegdipaiyryglegll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5fB (B:)
    lkikvigvggagnnainrmieigihgvefvavntdlqvleasnadvkiqigenitrglga
    ggrpeigeqaaleseekirevlqdthmvfitagfgggtgtgaspviakiakemgiltvai
    vttpfyfegperlkkaieglkklrkhvdtlikisnnklmeelprdvkikdaflkadetlh
    qgvkgiselitkrgyirltsrfariesvmkdagaailgigvgkgehrareaakkameskl
    iehpvenassivfnitapsnirmeevheaamiirqnssedadvkfglifddevpddeirv
    ifiatrfpdedkilfp