PDB entry 1w5f

View 1w5f on RCSB PDB site
Description: ftsz, T7 mutated, domain swapped (t. maritima)
Class: cell division
Keywords: cell division, cell-division protein, complete proteome, GTP-binding, multigene family, septation, tubulin, ftsz, filament, z-ring, gtpase, domain swapped
Deposited on 2004-08-06, released 2004-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2032
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08398 (222-End)
      • engineered see remark (217)
      • engineered see remark (219)
      • engineered see remark (224)
    • PDB 1W5F (220-221)
    Domains in SCOPe 2.07: d1w5fa1, d1w5fa2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08398 (222-End)
      • engineered see remark (217)
      • engineered see remark (219)
      • engineered see remark (224)
    • PDB 1W5F (220-221)
    Domains in SCOPe 2.07: d1w5fb1, d1w5fb2
  • Heterogens: G2P, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w5fA (A:)
    mgfdldvekkkenrnipqannlkikvigvggagnnainrmieigihgvefvavntdlqvl
    easnadvkiqigenitrglgaggrpeigeqaaleseekirevlqdthmvfitagfgggtg
    tgaspviakiakemgiltvaivttpfyfegperlkkaieglkklrkhvdtlikisnnklm
    eelprdvkikdaflkadetlhqgvkgiselitkrgyirltsrfariesvmkdagaailgi
    gvgkgehrareaakkameskliehpvenassivfnitapsnirmeevheaamiirqnsse
    dadvkfglifddevpddeirvifiatrfpdedkilfpegdipaiyryglegll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5fA (A:)
    lkikvigvggagnnainrmieigihgvefvavntdlqvleasnadvkiqigenitrglga
    ggrpeigeqaaleseekirevlqdthmvfitagfgggtgtgaspviakiakemgiltvai
    vttpfyfegperlkkaieglkklrkhvdtlikisnnklmeelprdvkikdaflkadetlh
    qgvkgiselitkrgyirltsrfariesvmkdagaailgigvgkgehrareaakkameskl
    iehpvenassivfnitapsnirmeevheaamiirqnssedadvkfglifddevpddeirv
    ifiatrfpdedkilfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w5fB (B:)
    mgfdldvekkkenrnipqannlkikvigvggagnnainrmieigihgvefvavntdlqvl
    easnadvkiqigenitrglgaggrpeigeqaaleseekirevlqdthmvfitagfgggtg
    tgaspviakiakemgiltvaivttpfyfegperlkkaieglkklrkhvdtlikisnnklm
    eelprdvkikdaflkadetlhqgvkgiselitkrgyirltsrfariesvmkdagaailgi
    gvgkgehrareaakkameskliehpvenassivfnitapsnirmeevheaamiirqnsse
    dadvkfglifddevpddeirvifiatrfpdedkilfpegdipaiyryglegll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5fB (B:)
    lkikvigvggagnnainrmieigihgvefvavntdlqvleasnadvkiqigenitrglga
    ggrpeigeqaaleseekirevlqdthmvfitagfgggtgtgaspviakiakemgiltvai
    vttpfyfegperlkkaieglkklrkhvdtlikisnnklmeelprdvkikdaflkadetlh
    qgvkgiselitkrgyirltsrfariesvmkdagaailgigvgkgehrareaakkameskl
    iehpvenassivfnitapsnirmeevheaamiirqnssedadvkfglifddevpddeirv
    ifiatrfpdedkilfp