Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Cell-division protein FtsZ [55309] (9 species) |
Species Thermotoga maritima [TaxId:2336] [118029] (1 PDB entry) Uniprot O08398 22-335 |
Domain d1w5fa2: 1w5f A:216-336 [114248] Other proteins in same PDB: d1w5fa1, d1w5fb1 complexed with g2p, mg missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1w5f (more details), 2 Å
SCOPe Domain Sequences for d1w5fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5fa2 d.79.2.1 (A:216-336) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} yirltsrfariesvmkdagaailgigvgkgehrareaakkameskliehpvenassivfn itapsnirmeevheaamiirqnssedadvkfglifddevpddeirvifiatrfpdedkil f
Timeline for d1w5fa2: