Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: IpsF-like [69765] (2 families) forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
Protein IspD/ispF bifunctional enzyme, MECDP synthase domain [118027] (1 species) |
Species Campylobacter jejuni [TaxId:197] [118028] (2 PDB entries) Uniprot Q9PM68 |
Domain d1w55a2: 1w55 A:208-370 [114198] Other proteins in same PDB: d1w55a1 complexed with c, edo, gpp, mg |
PDB Entry: 1w55 (more details), 2.3 Å
SCOPe Domain Sequences for d1w55a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w55a2 d.79.5.1 (A:208-370) IspD/ispF bifunctional enzyme, MECDP synthase domain {Campylobacter jejuni [TaxId: 197]} feiftgngfdvhefgenrplllagvqihptmglkahsdgdvlahsltdailgaaglgdig elypdtdmkfknansmellkqaydkvreigfelinidicvmaqspklkdfkqamqsniah tldldefrinvkattteklgfigrkegmavlssvnlkyfdwtr
Timeline for d1w55a2: