SCOPe 2.08: Domain d1w55a2: 1w55 A:208-370

Lineage for d1w55a2 (1w55 A:208-370)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein IspD/ispF bifunctional enzyme, MECDP synthase domain [118027] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [118028] (2 PDB entries)
   Uniprot Q9PM68

8. Domain d1w55a2: 1w55 A:208-370 [114198]
   Other proteins in same PDB: d1w55a1
   complexed with c, edo, gpp, mg

Details for d1w55a2

PDB Entry: 1w55, 2.3 Å

PDB Description: structure of the bifunctional ispdf from campylobacter jejuni

PDB Compounds: (A:) ispd/ispf bifunctional enzyme

SCOPe Domain Sequences for d1w55a2:

Sequence; same for both SEQRES and ATOM records:

>d1w55a2 d.79.5.1 (A:208-370) IspD/ispF bifunctional enzyme, MECDP synthase domain {Campylobacter jejuni [TaxId: 197]}
feiftgngfdvhefgenrplllagvqihptmglkahsdgdvlahsltdailgaaglgdig
elypdtdmkfknansmellkqaydkvreigfelinidicvmaqspklkdfkqamqsniah
tldldefrinvkattteklgfigrkegmavlssvnlkyfdwtr

Timeline for d1w55a2:

• d1w55a2 first appeared in SCOP 1.71
  
• d1w55a2 appears in SCOPe 2.07