PDB entry 1w55

View 1w55 on RCSB PDB site
Description: structure of the bifunctional ispdf from campylobacter jejuni
Class: transferase
Keywords: bifunctional enzyme, biosynthetic pathway, isoprenoids, bifunctional, nonmevalonate, transferase
Deposited on 2004-08-05, released 2004-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ispd/ispf bifunctional enzyme
    Species: CAMPYLOBACTER JEJUNI [TaxId:197]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w55a1, d1w55a2
  • Heterogens: MG, C, GPP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w55A (A:)
    msemslimlaagnstrfntkvkkqflrlgndplwlyatknlssfypfkkivvtssnitym
    kkftknyefieggdtraeslkkalelidsefvmvsdvarvlvsknlfdrlienldkadci
    tpalkvadttlfdnealqrekikliqtpqisktkllkkaldqnleftddstaiaamggki
    wfvegeenarkltfkedlkkldlptpsfeiftgngfdvhefgenrplllagvqihptmgl
    kahsdgdvlahsltdailgaaglgdigelypdtdmkfknansmellkqaydkvreigfel
    inidicvmaqspklkdfkqamqsniahtldldefrinvkattteklgfigrkegmavlss
    vnlkyfdwtrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w55A (A:)
    semslimlaagnstrfntkvkkqflrlgndplwlyatknlssfypfkkivvtssnitymk
    kftknyefieggdtraeslkkalelidsefvmvsdvarvlvsknlfdrlienldkadcit
    palkvadttlfdnealqrekikliqtpqisktkllkkaldqnleftddstaiaamggkiw
    fvegeenarkltfkedlkkldlptpsfeiftgngfdvhefgenrplllagvqihptmglk
    ahsdgdvlahsltdailgaaglgdigelypdtdmkfknansmellkqaydkvreigfeli
    nidicvmaqspklkdfkqamqsniahtldldefrinvkattteklgfigrkegmavlssv
    nlkyfdwtr