SCOPe 2.08: Domain d1w55a1: 1w55 A:3-207

Lineage for d1w55a1 (1w55 A:3-207)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)

6. Protein IspD/IspF bifunctional enzyme, CDP-me synthase domain [117700] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [117701] (2 PDB entries)
   Uniprot Q9PM68

8. Domain d1w55a1: 1w55 A:3-207 [114197]
   Other proteins in same PDB: d1w55a2
   complexed with c, edo, gpp, mg

Details for d1w55a1

PDB Entry: 1w55, 2.3 Å

PDB Description: structure of the bifunctional ispdf from campylobacter jejuni

PDB Compounds: (A:) ispd/ispf bifunctional enzyme

SCOPe Domain Sequences for d1w55a1:

Sequence; same for both SEQRES and ATOM records:

>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]}
emslimlaagnstrfntkvkkqflrlgndplwlyatknlssfypfkkivvtssnitymkk
ftknyefieggdtraeslkkalelidsefvmvsdvarvlvsknlfdrlienldkadcitp
alkvadttlfdnealqrekikliqtpqisktkllkkaldqnleftddstaiaamggkiwf
vegeenarkltfkedlkkldlptps

Timeline for d1w55a1:

• d1w55a1 first appeared in SCOP 1.71
  
• d1w55a1 appears in SCOPe 2.07