| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
| Family d.139.1.1: PurM C-terminal domain-like [56043] (7 proteins) |
| Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species) |
| Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries) Uniprot O67883 |
| Domain d1vqvb2: 1vqv B:138-300 [114027] Other proteins in same PDB: d1vqva1, d1vqvb1 structural genomics target complexed with po4 |
PDB Entry: 1vqv (more details), 2.65 Å
SCOPe Domain Sequences for d1vqvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqvb2 d.139.1.1 (B:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep
Timeline for d1vqvb2: