SCOPe 2.08: Domain d1vqvb2: 1vqv B:138-300

Lineage for d1vqvb2 (1vqv B:138-300)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)

6. Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries)
   Uniprot O67883

8. Domain d1vqvb2: 1vqv B:138-300 [114027]
   Other proteins in same PDB: d1vqva1, d1vqvb1
   structural genomics target
   complexed with po4

Details for d1vqvb2

PDB Entry: 1vqv, 2.65 Å

PDB Description: crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus

PDB Compounds: (B:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d1vqvb2:

Sequence; same for both SEQRES and ATOM records:

>d1vqvb2 d.139.1.1 (B:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep

Timeline for d1vqvb2:

• d1vqvb2 first appeared in SCOP 1.71
  
• d1vqvb2 appears in SCOPe 2.07