Lineage for d1vqva2 (1vqv A:138-300)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540993Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2540994Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2540995Family d.139.1.1: PurM C-terminal domain-like [56043] (7 proteins)
  6. 2541052Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species)
  7. 2541053Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries)
    Uniprot O67883
  8. 2541058Domain d1vqva2: 1vqv A:138-300 [114025]
    Other proteins in same PDB: d1vqva1, d1vqvb1
    structural genomics target
    complexed with po4

Details for d1vqva2

PDB Entry: 1vqv (more details), 2.65 Å

PDB Description: crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus
PDB Compounds: (A:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d1vqva2:

Sequence, based on SEQRES records: (download)

>d1vqva2 d.139.1.1 (A:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep

Sequence, based on observed residues (ATOM records): (download)

>d1vqva2 d.139.1.1 (A:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveeggvfvdgkkvep

SCOPe Domain Coordinates for d1vqva2:

Click to download the PDB-style file with coordinates for d1vqva2.
(The format of our PDB-style files is described here.)

Timeline for d1vqva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vqva1