| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class sigma GST [81362] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89705] (16 PDB entries) Uniprot O60760 synonym: hematopoietic prostaglandin D synthase |
| Domain d1v40d2: 1v40 D:602-675 [113519] Other proteins in same PDB: d1v40a1, d1v40b1, d1v40c1, d1v40d1 complexed with gol, gsh, mg, o16 |
PDB Entry: 1v40 (more details), 1.9 Å
SCOPe Domain Sequences for d1v40d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v40d2 c.47.1.5 (D:602-675) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt
Timeline for d1v40d2: