![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class sigma GST [81351] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89061] (16 PDB entries) Uniprot O60760; synonym: hematopoietic prostaglandin D synthase |
![]() | Domain d1v40c1: 1v40 C:476-599 [113516] Other proteins in same PDB: d1v40a2, d1v40b2, d1v40c2, d1v40d2 complexed with gol, gsh, mg, o16 |
PDB Entry: 1v40 (more details), 1.9 Å
SCOPe Domain Sequences for d1v40c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v40c1 a.45.1.1 (C:476-599) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp qtkl
Timeline for d1v40c1: