Lineage for d1upsb1 (1ups B:19-284)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1533532Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (6 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 1533570Protein GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, catalytic domain [117134] (1 species)
  7. 1533571Species Clostridium perfringens [TaxId:1502] [117135] (1 PDB entry)
    Uniprot Q934G8 17-420
  8. 1533573Domain d1upsb1: 1ups B:19-284 [113396]
    Other proteins in same PDB: d1upsa2, d1upsb2
    complexed with ca

Details for d1upsb1

PDB Entry: 1ups (more details), 1.82 Å

PDB Description: glcnac[alpha]1-4gal releasing endo-[beta]-galactosidase from clostridium perfringens
PDB Compounds: (B:) glcnac-alpha-1,4-gal-releasing endo-beta-galactosidase

SCOPe Domain Sequences for d1upsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upsb1 b.29.1.2 (B:19-284) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, catalytic domain {Clostridium perfringens [TaxId: 1502]}
dfpanpiekagykldfsdefngptldrekwtdyylphwckdpesakanyrfengslveyi
tedqkpwcpehdgtvrssaimsfdkswihnfsgttdnhernewrgyttkygyfeirakls
ntgggghqawwmvgmqddtndwfnskqtgeidiletffskkdtwriaaygwndpnfqtsw
tisedkvpsgdptseyhiyamewtptalkfyydnelfkviygspdyemgtilniytdags
gahndvwpkewaidymrvwkpvdgyk

SCOPe Domain Coordinates for d1upsb1:

Click to download the PDB-style file with coordinates for d1upsb1.
(The format of our PDB-style files is described here.)

Timeline for d1upsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1upsb2