Lineage for d1upra_ (1upr A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412584Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2412728Protein Phosphoinositol 3-phosphate binding protein-1, PEPP1 [117244] (1 species)
  7. 2412729Species Human (Homo sapiens) [TaxId:9606] [117245] (2 PDB entries)
    Uniprot Q9H4M7 47-153
  8. 2412731Domain d1upra_: 1upr A: [113393]
    complexed with 4ip

Details for d1upra_

PDB Entry: 1upr (more details), 2.27 Å

PDB Description: crystal structure of the pepp1 pleckstrin homology domain in complex with inositol 1,3,4,5-tetrakisphosphate
PDB Compounds: (A:) pleckstrin homology domain-containing family a member 4

SCOPe Domain Sequences for d1upra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upra_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]}
lrrdpnlpvhirgwlhkqdssglrlwkrrwfvlsghclfyykdsreesvlgsvllpsyni
rpdgpgaprgrrftftaehpgmrtyvlaadtledlrgwlralgrasr

SCOPe Domain Coordinates for d1upra_:

Click to download the PDB-style file with coordinates for d1upra_.
(The format of our PDB-style files is described here.)

Timeline for d1upra_: