![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein Phosphoinositol 3-phosphate binding protein-1, PEPP1 [117244] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117245] (2 PDB entries) Uniprot Q9H4M7 47-153 |
![]() | Domain d1upra_: 1upr A: [113393] complexed with 4ip |
PDB Entry: 1upr (more details), 2.27 Å
SCOPe Domain Sequences for d1upra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upra_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} lrrdpnlpvhirgwlhkqdssglrlwkrrwfvlsghclfyykdsreesvlgsvllpsyni rpdgpgaprgrrftftaehpgmrtyvlaadtledlrgwlralgrasr
Timeline for d1upra_: