![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins) family 4 glycosyl hydrolase automatically mapped to Pfam PF11975 |
![]() | Protein 6-phospho-beta-glucosidase [111254] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [111256] (3 PDB entries) Uniprot Q9X108 |
![]() | Domain d1up4f2: 1up4 F:163-415 [113369] Other proteins in same PDB: d1up4a1, d1up4b1, d1up4c1, d1up4d1, d1up4e1, d1up4f1, d1up4g1, d1up4h1 |
PDB Entry: 1up4 (more details), 2.85 Å
SCOPe Domain Sequences for d1up4f2:
Sequence, based on SEQRES records: (download)
>d1up4f2 d.162.1.2 (F:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnip dedfptwfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtavei peeltkrggsmystaaahlirdletdegkihivntrnngsienlpddyvleipcyvrsgr vhtlsqgkgdhfalsfihavkmyerltieaylkrskklalkallshplgpdvedakdlle eileanreyvklg
>d1up4f2 d.162.1.2 (F:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlkdedfptw fydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtaveipmystaa ahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsf ihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
Timeline for d1up4f2: