PDB entry 1up4

View 1up4 on RCSB PDB site
Description: Structure of the 6-phospho-beta glucosidase from Thermotoga maritima at 2.85 Angstrom resolution in the monoclinic form
Class: hydrolase
Keywords: hydrolase, 6-phospho-beta-glucosidase, family4 hydrolase, nad-dependent
Deposited on 2003-09-26, released 2004-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1up4a1, d1up4a2
  • Chain 'B':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1up4b1, d1up4b2
  • Chain 'C':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1up4c1, d1up4c2
  • Chain 'D':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1up4d1, d1up4d2
  • Chain 'E':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1up4e1, d1up4e2
  • Chain 'F':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1up4f1, d1up4f2
  • Chain 'G':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1up4g1, d1up4g2
  • Chain 'H':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1up4h1, d1up4h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1up4A (A:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivnp
    ylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaah
    lirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfih
    avkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up4A (A:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklkdedfptwfydsvrlivnpylryy
    lmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaahlirdl
    etdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmy
    erltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1up4B (B:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivnp
    ylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaah
    lirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfih
    avkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up4B (B:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklkedfptwfydsvrlivnpylryyl
    mekkmfkkisthelrarevmkiekelfekyrtaveipeesmystaaahlirdletdegki
    hivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerltiea
    ylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1up4C (C:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivnp
    ylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaah
    lirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfih
    avkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up4C (C:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlkledfptwfydsvrlivnpylryylm
    ekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaahlirdlet
    degkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyer
    ltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1up4D (D:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivnp
    ylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaah
    lirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfih
    avkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up4D (D:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlkledfptwfydsvrlivnpylryylm
    ekkmfkkisthelrarevmkiekelfekyrtaveipemystaaahlirdletdegkihiv
    ntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerltieaylk
    rskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1up4E (E:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivnp
    ylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaah
    lirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfih
    avkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up4E (E:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklkdfptwfydsvrlivnpylryylm
    ekkmfkkisthelrarevmkiekelfekipegsmystaaahlirdletdegkihivntrn
    ngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerltieaylkrskk
    lalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1up4F (F:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivnp
    ylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaah
    lirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfih
    avkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up4F (F:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlkdedfptwfydsvrlivnpylryylm
    ekkmfkkisthelrarevmkiekelfekyrtaveipmystaaahlirdletdegkihivn
    trnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerltieaylkr
    skklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1up4G (G:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivnp
    ylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaah
    lirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfih
    avkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up4G (G:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlkldedfptwfydsvrlivnpylryyl
    mekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaahlirdle
    tdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmye
    rltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1up4H (H:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivnp
    ylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaah
    lirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfih
    avkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up4H (H:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlkldedfptwfydsvrlivnpylryyl
    mekkmfkkisthelrarevmkiekelfekyrtaveipeesmystaaahlirdletdegki
    hivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerltiea
    ylkrskklalkallshplgpdvedakdlleeileanreyvklg