Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein 6-phospho-beta-glucosidase [110428] (2 species) |
Species Thermotoga maritima [TaxId:2336] [110430] (3 PDB entries) Uniprot Q9X108 |
Domain d1up4f1: 1up4 F:1-162 [113368] Other proteins in same PDB: d1up4a2, d1up4b2, d1up4c2, d1up4d2, d1up4e2, d1up4f2, d1up4g2, d1up4h2 |
PDB Entry: 1up4 (more details), 2.85 Å
SCOPe Domain Sequences for d1up4f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1up4f1 c.2.1.5 (F:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglc
Timeline for d1up4f1: