Lineage for d1up4g2 (1up4 G:163-415)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557344Family d.162.1.2: AglA-like glucosidase [90050] (5 protein domains)
    family 4 glycosyl hydrolase
    automatically mapped to Pfam PF11975
  6. 2557345Protein 6-phospho-beta-glucosidase [111254] (2 species)
  7. 2557348Species Thermotoga maritima [TaxId:2336] [111256] (3 PDB entries)
    Uniprot Q9X108
  8. 2557371Domain d1up4g2: 1up4 G:163-415 [113371]
    Other proteins in same PDB: d1up4a1, d1up4b1, d1up4c1, d1up4d1, d1up4e1, d1up4f1, d1up4g1, d1up4h1

Details for d1up4g2

PDB Entry: 1up4 (more details), 2.85 Å

PDB Description: structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.85 angstrom resolution in the monoclinic form
PDB Compounds: (G:) 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d1up4g2:

Sequence, based on SEQRES records: (download)

>d1up4g2 d.162.1.2 (G:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]}
nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnip
dedfptwfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtavei
peeltkrggsmystaaahlirdletdegkihivntrnngsienlpddyvleipcyvrsgr
vhtlsqgkgdhfalsfihavkmyerltieaylkrskklalkallshplgpdvedakdlle
eileanreyvklg

Sequence, based on observed residues (ATOM records): (download)

>d1up4g2 d.162.1.2 (G:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]}
nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlkldedfpt
wfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltk
rggsmystaaahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsq
gkgdhfalsfihavkmyerltieaylkrskklalkallshplgpdvedakdlleeilean
reyvklg

SCOPe Domain Coordinates for d1up4g2:

Click to download the PDB-style file with coordinates for d1up4g2.
(The format of our PDB-style files is described here.)

Timeline for d1up4g2: