Lineage for d1ulub_ (1ulu B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1151047Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1151500Protein Enoyl-ACP reductase [51791] (11 species)
  7. 1151705Species Thermus thermophilus [TaxId:274] [117409] (1 PDB entry)
    Uniprot Q5SLI9
  8. 1151707Domain d1ulub_: 1ulu B: [113293]

Details for d1ulub_

PDB Entry: 1ulu (more details), 2 Å

PDB Description: Crystal structure of tt0143 from Thermus thermophilus HB8
PDB Compounds: (B:) enoyl-acyl carrier protein reductase

SCOPe Domain Sequences for d1ulub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulub_ c.2.1.2 (B:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]}
mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
itgevvyvdagyhimgm

SCOPe Domain Coordinates for d1ulub_:

Click to download the PDB-style file with coordinates for d1ulub_.
(The format of our PDB-style files is described here.)

Timeline for d1ulub_: