Lineage for d1ulub_ (1ulu B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574451Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 574721Protein Enoyl-ACP reductase [51791] (6 species)
  7. 574803Species scop new_sp Thermus thermophilus [117409] (1 PDB entry)
  8. 574805Domain d1ulub_: 1ulu B: [113293]

Details for d1ulub_

PDB Entry: 1ulu (more details), 2 Å

PDB Description: Crystal structure of tt0143 from Thermus thermophilus HB8

SCOP Domain Sequences for d1ulub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulub_ c.2.1.2 (B:) Enoyl-ACP reductase {scop new_sp Thermus thermophilus}
mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
itgevvyvdagyhimgm

SCOP Domain Coordinates for d1ulub_:

Click to download the PDB-style file with coordinates for d1ulub_.
(The format of our PDB-style files is described here.)

Timeline for d1ulub_: