Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Enoyl-ACP reductase [51791] (6 species) |
Species scop new_sp Thermus thermophilus [117409] (1 PDB entry) |
Domain d1ulub_: 1ulu B: [113293] |
PDB Entry: 1ulu (more details), 2 Å
SCOP Domain Sequences for d1ulub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulub_ c.2.1.2 (B:) Enoyl-ACP reductase {scop new_sp Thermus thermophilus} mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg itgevvyvdagyhimgm
Timeline for d1ulub_: