Lineage for d1ulsg_ (1uls G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841624Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 2841675Species Thermus thermophilus [TaxId:274] [117407] (1 PDB entry)
    Uniprot Q5SK98
  8. 2841682Domain d1ulsg_: 1uls G: [113290]
    Structural genomics target

Details for d1ulsg_

PDB Entry: 1uls (more details), 2.4 Å

PDB Description: Crystal structure of tt0140 from Thermus thermophilus HB8
PDB Compounds: (G:) putative 3-oxoacyl-acyl carrier protein reductase

SCOPe Domain Sequences for d1ulsg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulsg_ c.2.1.2 (G:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]}
mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
gaapa

SCOPe Domain Coordinates for d1ulsg_:

Click to download the PDB-style file with coordinates for d1ulsg_.
(The format of our PDB-style files is described here.)

Timeline for d1ulsg_: