PDB entry 1uls

View 1uls on RCSB PDB site
Description: Crystal structure of tt0140 from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: reductase, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2003-09-16, released 2004-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative 3-oxoacyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ulsa_
  • Chain 'B':
    Compound: putative 3-oxoacyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ulsb_
  • Chain 'C':
    Compound: putative 3-oxoacyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ulsc_
  • Chain 'D':
    Compound: putative 3-oxoacyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ulsd_
  • Chain 'E':
    Compound: putative 3-oxoacyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ulse_
  • Chain 'F':
    Compound: putative 3-oxoacyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ulsf_
  • Chain 'G':
    Compound: putative 3-oxoacyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ulsg_
  • Chain 'H':
    Compound: putative 3-oxoacyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ulsh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ulsA (A:)
    mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
    pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
    eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
    ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
    gaapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulsA (A:)
    mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
    pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
    eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
    ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
    ga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulsB (B:)
    mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
    pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
    eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
    ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
    gaapa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ulsC (C:)
    mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
    pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
    eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
    ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
    gaapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulsC (C:)
    mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
    pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
    eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
    ietpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrtigaapa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulsD (D:)
    mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
    pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
    eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
    ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
    gaapa
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulsE (E:)
    mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
    pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
    eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
    ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
    gaapa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ulsF (F:)
    mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
    pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
    eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
    ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
    gaapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulsF (F:)
    mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
    pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
    eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
    ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
    ga
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulsG (G:)
    mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
    pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
    eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
    ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
    gaapa
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulsH (H:)
    mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
    pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
    eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
    ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
    gaapa