Lineage for d1ulqc1 (1ulq C:2-275)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1186520Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1186521Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1186522Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 1186773Protein Beta-ketoadipyl CoA thiolase [117750] (1 species)
  7. 1186774Species Thermus thermophilus [TaxId:274] [117751] (1 PDB entry)
    Uniprot Q5SJM1
  8. 1186779Domain d1ulqc1: 1ulq C:2-275 [113271]
    Structural genomics target

Details for d1ulqc1

PDB Entry: 1ulq (more details), 3 Å

PDB Description: Crystal structure of tt0182 from Thermus thermophilus HB8
PDB Compounds: (C:) putative acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1ulqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulqc1 c.95.1.1 (C:2-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]}
peawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqage
dnrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsr
apyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeq
drfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvf
reggtvtagnssplndgaaavllvsddyakahgl

SCOPe Domain Coordinates for d1ulqc1:

Click to download the PDB-style file with coordinates for d1ulqc1.
(The format of our PDB-style files is described here.)

Timeline for d1ulqc1: