Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (8 proteins) |
Protein Beta-ketoadipyl CoA thiolase [117750] (1 species) |
Species Thermus thermophilus [TaxId:274] [117751] (1 PDB entry) Uniprot Q5SJM1 |
Domain d1ulqa2: 1ulq A:276-400 [113268] Structural genomics target |
PDB Entry: 1ulq (more details), 3 Å
SCOPe Domain Sequences for d1ulqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} rplarvraiavagvpprimgigpvpatrkaleraglsfsdlglielneafaaqalavlre wslsmedqrlnpnggaialghplgasgarilttlvhemrrrkvqfglatmcigvgqgiav vvegm
Timeline for d1ulqa2: