SCOPe 2.08: Domain d1u8yb_: 1u8y B:

Lineage for d1u8yb_ (1u8y B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ras-related protein RalA [89662] (2 species)

7. Species Cotton-top tamarin (Saguinus oedipus) [TaxId:9490] [117532] (3 PDB entries)
   Uniprot P63320 # 100% identical to the mouse and rat orthologs (Uniprot P63321 P63322)

8. Domain d1u8yb_: 1u8y B: [113211]
   complexed with gnp, mg

Details for d1u8yb_

PDB Entry: 1u8y, 1.55 Å

PDB Description: CRystal structures of Ral-GppNHp and Ral-GDP reveal two novel binding sites that are also present in Ras and Rap

PDB Compounds: (B:) Ras-related protein Ral-A

SCOPe Domain Sequences for d1u8yb_:

Sequence; same for both SEQRES and ATOM records:

>d1u8yb_ c.37.1.8 (B:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar

Timeline for d1u8yb_:

• d1u8yb_ first appeared in SCOP 1.71
  
• d1u8yb_ appears in SCOPe 2.07