![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Ras-related protein RalA [89662] (2 species) |
![]() | Species Cotton-top tamarin (Saguinus oedipus) [TaxId:9490] [117532] (3 PDB entries) Uniprot P63320 # 100% identical to the mouse and rat orthologs (Uniprot P63321 P63322) |
![]() | Domain d1u8ya_: 1u8y A: [113210] complexed with gnp, mg |
PDB Entry: 1u8y (more details), 1.55 Å
SCOPe Domain Sequences for d1u8ya_:
Sequence, based on SEQRES records: (download)
>d1u8ya_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar
>d1u8ya_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} slalhkvimvgsggvgksaltlqfmydefvedyepksyrkkvvldgeevqidildtagfr sgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdledkrqvsveeakn radqwnvnyvetsaktranvdkvffdlmreirar
Timeline for d1u8ya_: