Class a: All alpha proteins [46456] (290 folds) |
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) |
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
Protein AKV capsid [116949] (2 species) |
Species AKV murine leukemia virus [TaxId:11791] [116950] (1 PDB entry) Uniprot P03336 215-345 # fragment of the core shell protein p30 (215-477) |
Domain d1u7kf_: 1u7k F: [113092] |
PDB Entry: 1u7k (more details), 1.85 Å
SCOPe Domain Sequences for d1u7kf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u7kf_ a.73.1.1 (F:) AKV capsid {AKV murine leukemia virus [TaxId: 11791]} plrmggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdyttqrgrnhlvlyrq lllagmqnagr
Timeline for d1u7kf_: