Lineage for d1u7kd_ (1u7k D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717819Protein AKV capsid [116949] (2 species)
  7. 2717820Species AKV murine leukemia virus [TaxId:11791] [116950] (1 PDB entry)
    Uniprot P03336 215-345 # fragment of the core shell protein p30 (215-477)
  8. 2717824Domain d1u7kd_: 1u7k D: [113090]

Details for d1u7kd_

PDB Entry: 1u7k (more details), 1.85 Å

PDB Description: Structure of a hexameric N-terminal domain from murine leukemia virus capsid
PDB Compounds: (D:) gag polyprotein

SCOPe Domain Sequences for d1u7kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7kd_ a.73.1.1 (D:) AKV capsid {AKV murine leukemia virus [TaxId: 11791]}
plrmggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdyttqrgrnhlvlyrq
lllagmqnagr

SCOPe Domain Coordinates for d1u7kd_:

Click to download the PDB-style file with coordinates for d1u7kd_.
(The format of our PDB-style files is described here.)

Timeline for d1u7kd_: