Lineage for d1u7kf_ (1u7k F:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540286Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 540287Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 540288Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (5 proteins)
  6. 540289Protein AKV capsid [116949] (1 species)
  7. 540290Species AKV murine leukemia virus [TaxId:11791] [116950] (1 PDB entry)
  8. 540296Domain d1u7kf_: 1u7k F: [113092]

Details for d1u7kf_

PDB Entry: 1u7k (more details), 1.85 Å

PDB Description: Structure of a hexameric N-terminal domain from murine leukemia virus capsid

SCOP Domain Sequences for d1u7kf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7kf_ a.73.1.1 (F:) AKV capsid {AKV murine leukemia virus}
plrmggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdyttqrgrnhlvlyrq
lllagmqnagr

SCOP Domain Coordinates for d1u7kf_:

Click to download the PDB-style file with coordinates for d1u7kf_.
(The format of our PDB-style files is described here.)

Timeline for d1u7kf_: