Lineage for d1u6mc_ (1u6m C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609081Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 609082Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) (S)
  5. 609083Family d.108.1.1: N-acetyl transferase, NAT [55730] (25 proteins)
  6. 609211Protein Putative acetyltransferase EF0945 [118070] (1 species)
  7. 609212Species Enterococcus faecalis [TaxId:1351] [118071] (1 PDB entry)
  8. 609215Domain d1u6mc_: 1u6m C: [113071]

Details for d1u6mc_

PDB Entry: 1u6m (more details), 2.4 Å

PDB Description: the crystal structure of acetyltransferase

SCOP Domain Sequences for d1u6mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6mc_ d.108.1.1 (C:) Putative acetyltransferase EF0945 {Enterococcus faecalis}
slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
ynhmqkeve

SCOP Domain Coordinates for d1u6mc_:

Click to download the PDB-style file with coordinates for d1u6mc_.
(The format of our PDB-style files is described here.)

Timeline for d1u6mc_: