PDB entry 1u6m

View 1u6m on RCSB PDB site
Description: the crystal structure of acetyltransferase
Deposited on 2004-07-30, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u6ma_
  • Chain 'B':
    Domains in SCOP 1.71: d1u6mb_
  • Chain 'C':
    Domains in SCOP 1.71: d1u6mc_
  • Chain 'D':
    Domains in SCOP 1.71: d1u6md_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u6mA (A:)
    mslirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqril
    vyehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisv
    derfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisgh
    lynhmqkeveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6mA (A:)
    slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
    yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
    erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
    ynhmqkeve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u6mB (B:)
    mslirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqril
    vyehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisv
    derfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisgh
    lynhmqkeveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6mB (B:)
    slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
    yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
    erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
    ynhmqkeve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u6mC (C:)
    mslirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqril
    vyehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisv
    derfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisgh
    lynhmqkeveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6mC (C:)
    slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
    yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
    erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
    ynhmqkeve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u6mD (D:)
    mslirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqril
    vyehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisv
    derfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisgh
    lynhmqkeveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6mD (D:)
    slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
    yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
    erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
    ynhmqkeve