![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Putative acetyltransferase EF0945 [118070] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [118071] (1 PDB entry) Uniprot Q836Z8 |
![]() | Domain d1u6mc1: 1u6m C:4-189 [113071] Other proteins in same PDB: d1u6ma2, d1u6ma3, d1u6mb2, d1u6mb3, d1u6mc2, d1u6mc3, d1u6md2, d1u6md3 Structural genomics target complexed with so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1u6m (more details), 2.4 Å
SCOPe Domain Sequences for d1u6mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6mc1 d.108.1.1 (C:4-189) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} irsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilvye hagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvder frgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghlyn hmqkev
Timeline for d1u6mc1: