![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.1: Spectrin repeat [46966] (2 families) ![]() |
![]() | Family a.7.1.1: Spectrin repeat [46967] (3 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
![]() | Protein Spectrin alpha chain [46968] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries) Uniprot P07751 1662-1981 |
![]() | Domain d1u4qb3: 1u4q B:1879-1979 [113029] repeats 15, 16 and 17 |
PDB Entry: 1u4q (more details), 2.5 Å
SCOPe Domain Sequences for d1u4qb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u4qb3 a.7.1.1 (B:1879-1979) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} qfvanveeeeawinekmtlvasedygdtlaaiqgllkkheafetdftvhkdrvndvcang edlikknnhhvenitakmkglkgkvsdlekaaaqrkaklde
Timeline for d1u4qb3: