Lineage for d1u4qa2 (1u4q A:1772-1878)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308817Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2308818Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 2308819Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
  6. 2308832Protein Spectrin alpha chain [46968] (3 species)
  7. 2308833Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)
    Uniprot P07751 1662-1981
  8. 2308843Domain d1u4qa2: 1u4q A:1772-1878 [113025]
    repeats 15, 16 and 17

Details for d1u4qa2

PDB Entry: 1u4q (more details), 2.5 Å

PDB Description: Crystal Structure of Repeats 15, 16 and 17 of Chicken Brain Alpha Spectrin
PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d1u4qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4qa2 a.7.1.1 (A:1772-1878) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
hqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldt
gkklsddntigkeeiqqrlaqfvdhwkelkqlaaargqrleesleyq

SCOPe Domain Coordinates for d1u4qa2:

Click to download the PDB-style file with coordinates for d1u4qa2.
(The format of our PDB-style files is described here.)

Timeline for d1u4qa2: