Lineage for d1u4qb3 (1u4q B:1879-1979)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534473Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534474Superfamily a.7.1: Spectrin repeat [46966] (1 family) (S)
  5. 534475Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 534488Protein Spectrin alpha chain [46968] (3 species)
  7. 534489Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)
  8. 534503Domain d1u4qb3: 1u4q B:1879-1979 [113029]
    repeats 15, 16 and 17

Details for d1u4qb3

PDB Entry: 1u4q (more details), 2.5 Å

PDB Description: Crystal Structure of Repeats 15, 16 and 17 of Chicken Brain Alpha Spectrin

SCOP Domain Sequences for d1u4qb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4qb3 a.7.1.1 (B:1879-1979) Spectrin alpha chain {Chicken (Gallus gallus)}
qfvanveeeeawinekmtlvasedygdtlaaiqgllkkheafetdftvhkdrvndvcang
edlikknnhhvenitakmkglkgkvsdlekaaaqrkaklde

SCOP Domain Coordinates for d1u4qb3:

Click to download the PDB-style file with coordinates for d1u4qb3.
(The format of our PDB-style files is described here.)

Timeline for d1u4qb3: