Lineage for d1u3ma1 (1u3m A:128-242)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175107Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2175108Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2175109Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2175110Protein Prion protein domain [54100] (14 species)
  7. 2175117Species Chicken (Gallus gallus) [TaxId:9031] [117766] (1 PDB entry)
    Uniprot P27177 132-248
  8. 2175118Domain d1u3ma1: 1u3m A:128-242 [113000]
    Other proteins in same PDB: d1u3ma2

Details for d1u3ma1

PDB Entry: 1u3m (more details)

PDB Description: nmr structure of the chicken prion protein fragment 128-242
PDB Compounds: (A:) prion-like protein

SCOPe Domain Sequences for d1u3ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3ma1 d.6.1.1 (A:128-242) Prion protein domain {Chicken (Gallus gallus) [TaxId: 9031]}
vvgglggyamgrvmsgmnyhfdrpdeyrwwsensarypnrvyyrdysspvpqdvfvadcf
nitvteysigpaakkntseavaaanqtevemenkvvtkviremcvqqyreyrlas

SCOPe Domain Coordinates for d1u3ma1:

Click to download the PDB-style file with coordinates for d1u3ma1.
(The format of our PDB-style files is described here.)

Timeline for d1u3ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u3ma2