Lineage for d1u2vf_ (1u2v F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685231Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1685314Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1685315Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)
  6. 1685350Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 1685351Species Cow (Bos taurus) [TaxId:9913] [69648] (17 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 1685356Domain d1u2vf_: 1u2v F: [112995]
    Other proteins in same PDB: d1u2va1, d1u2va2, d1u2vb1, d1u2vc_, d1u2vd1, d1u2vd2, d1u2ve_, d1u2vg_
    complexed with adp, ca

Details for d1u2vf_

PDB Entry: 1u2v (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ADP and calcium
PDB Compounds: (F:) Arp2/3 complex 20kDa subunit

SCOPe Domain Sequences for d1u2vf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2vf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl
iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh
teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOPe Domain Coordinates for d1u2vf_:

Click to download the PDB-style file with coordinates for d1u2vf_.
(The format of our PDB-style files is described here.)

Timeline for d1u2vf_: