Lineage for d1u2vf_ (1u2v F:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 615745Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 615800Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 615801Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 615810Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 615811Species Cow (Bos taurus) [TaxId:9913] [69648] (3 PDB entries)
  8. 615813Domain d1u2vf_: 1u2v F: [112995]
    Other proteins in same PDB: d1u2va1, d1u2va2, d1u2vb1, d1u2vc_, d1u2vd1, d1u2vd2, d1u2ve_, d1u2vg_
    complexed with adp, ca

Details for d1u2vf_

PDB Entry: 1u2v (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ADP and calcium

SCOP Domain Sequences for d1u2vf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2vf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus)}
atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl
iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh
teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOP Domain Coordinates for d1u2vf_:

Click to download the PDB-style file with coordinates for d1u2vf_.
(The format of our PDB-style files is described here.)

Timeline for d1u2vf_: