![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) ![]() |
![]() | Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins) |
![]() | Protein ARPC4 (20 kDa subunit) [69647] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [69648] (16 PDB entries) Uniprot P59998 # 100% sequence identity |
![]() | Domain d1u2vf_: 1u2v F: [112995] Other proteins in same PDB: d1u2va1, d1u2va2, d1u2vb1, d1u2vc_, d1u2vd1, d1u2vd2, d1u2ve_, d1u2vg_ complexed with adp, ca |
PDB Entry: 1u2v (more details), 2.55 Å
SCOPe Domain Sequences for d1u2vf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2vf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]} atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
Timeline for d1u2vf_: